ARMCX3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000325

 

Antibody HPA000967

 

Antibody HPA001530

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000325 HPA000967 HPA001530 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 1 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

115 121 138 

Antigen sequence

MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAG
TRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPY
ILEAALIALGNNAAY
 
SAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVI
LKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIES
HHDFLVKVKVGKFMAKLAEHM
 
MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAG
TRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPY
ILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTR
 

Matching transcripts

ARMCX3-001 - ENSP00000340672 [100%]
ARMCX3-004 - ENSP00000454483 [100%]
ARMCX3-201 - ENSP00000439032 [100%]
 ARMCX3-001 - ENSP00000340672 [100%]
ARMCX3-004 - ENSP00000454483 [100%]
ARMCX3-201 - ENSP00000439032 [100%]
 ARMCX3-001 - ENSP00000340672 [100%]
ARMCX3-004 - ENSP00000454483 [100%]
ARMCX3-201 - ENSP00000439032 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
  

Retrieval method

HIER pH6 HIER pH6  

Antibody dilution

1:50 1:25  

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406053)
More information
 Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406053)
More information
 

Target mass (kDa)

42.5 42.5 42.5 

Antibody dilution

1:125 1:500 1:125 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1000 1:1000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in Golgi apparatus & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:30 1:20 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
ARMCX3-001
 
ARMCX3-004
 
ARMCX3-201