HTR2A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA014011

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA014011 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

63 

Antigen sequence

TIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIHREPGSY
TGRRTMQSISNEQ
 

Matching transcripts

HTR2A-001 - ENSP00000367959 [100%]
HTR2A-201 - ENSP00000437737 [100%]
HTR2A-202 - ENSP00000441861 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human lateral ventricle shows distinct positivity.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

52.6, 43.9 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
HTR2A-001
 
HTR2A-201
 
HTR2A-202