MAPK3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003995

 

Antibody HPA005700

 

Antibody HPA030069

 

Antibody CAB002683

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 

Product name

HPA003995 HPA005700 HPA030069 RB-9224 

Host species

Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

3 3 6 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

138 131 27  

Antigen sequence

YVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQ
LNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKA
LDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPV
 
EVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPF
EHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLME
TDLYKLLKSQQLSNDHICYFLYQILRGLKYI
 
YIVQDLMETDLYKLLKTQHLSNDHICY
 
 

Matching transcripts

MAPK3-001 - ENSP00000263025 [100%]
MAPK3-003 - ENSP00000432742 [100%]
MAPK3-006 - ENSP00000378625 [99%]
MAPK3-202 - ENSP00000384895 [99%]
MAPK3-011 - ENSP00000378626 [88%]
MAPK3-005 - ENSP00000432479 [85%]
 MAPK3-001 - ENSP00000263025 [100%]
MAPK3-002 - ENSP00000433746 [100%]
MAPK3-004 - ENSP00000378628 [100%]
MAPK3-005 - ENSP00000432479 [100%]
MAPK3-006 - ENSP00000378625 [100%]
MAPK3-201 - ENSP00000327293 [100%]
MAPK3-202 - ENSP00000384895 [100%]
MAPK3-011 - ENSP00000378626 [98%]
 MAPK3-001 - ENSP00000263025 [93%]
MAPK3-002 - ENSP00000433746 [93%]
MAPK3-003 - ENSP00000432742 [93%]
MAPK3-004 - ENSP00000378628 [93%]
MAPK3-005 - ENSP00000432479 [93%]
MAPK3-006 - ENSP00000378625 [93%]
MAPK3-007 - ENSP00000433639 [93%]
MAPK3-011 - ENSP00000378626 [93%]
MAPK3-201 - ENSP00000327293 [93%]
MAPK3-202 - ENSP00000384895 [93%]
  

Other gene match

MAPK1 - ENSG00000100030 [89%]
 MAPK1 - ENSG00000100030 [85%]
 MAPK1 - ENSG00000100030 [100%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human skeletal muscle shows cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity.
More information
 Immunohistochemical staining of human hippocampus shows strong cytoplasmic and nuclear positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:25 1:20 1:70 1:400 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein chara Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein chara Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein chara Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoskeleton (microtubules).
More information
  Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:36  1:20 1:100 

Validation IF

Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400968)
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

43.1, 41.4, 40.1, 38.5, 36.0, 30.6 43.1, 41.4, 40.1, 38.5, 38.3, 36.4, 36.0, 35.7 43.1, 41.4, 40.1, 38.5, 38.3, 36.4, 36.0, 35.7, 30.6, 10.2 43.1, 40.1, 38.5, 38.3, 36.0, 35.7, 30.6, 15.8, 13.8, 10.2 

Antibody dilution

1:250 1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:500 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MAPK3-001
 
MAPK3-002
 
MAPK3-003
 
MAPK3-004
 
MAPK3-005
 
MAPK3-006
 
MAPK3-007
 
MAPK3-011
 
MAPK3-201
 
MAPK3-202