ABCC1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002380

 

Antibody CAB016097

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA002380 sc-18835 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

5 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

142  

Antigen sequence

LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTE
QEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGD
ISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD
 
 

Matching transcripts

ABCC1-001 - ENSP00000382342 [100%]
ABCC1-201 - ENSP00000263014 [100%]
ABCC1-202 - ENSP00000263019 [100%]
ABCC1-203 - ENSP00000263016 [100%]
ABCC1-204 - ENSP00000263017 [100%]
ABCC1-007 - ENSP00000461615 [93%]
ABCC1-205 - ENSP00000382340 [93%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in a subset of cells in glomeruli.
More information
 Immunohistochemical staining of human stomach shows strong membranous positivity in Parietal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:250 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane.
More information
  

Antibody dilution

1:24  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

  

Target mass (kDa)

172.6, 171.6, 165.6, 165.0, 164.3, 160.4, 158.9 172.6, 171.6, 165.6, 165.0, 164.3, 160.4, 158.9, 2.5 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ABCC1-001
 
ABCC1-007
 
ABCC1-201
 
ABCC1-202
 
ABCC1-203
 
ABCC1-204
 
ABCC1-205