DNAJA3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040875

 

Antibody HPA044229

 

Antibody CAB016095

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA040875 HPA044229 sc-18820 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 12 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

94 93  

Antigen sequence

DPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTV
NIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRST
 
IAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGD
HYIHIKIRVPKRLTSRQQSLILSYAEDETDVEGTVNGVTLTSS
 
 

Matching transcripts

DNAJA3-001 - ENSP00000262375 [100%]
DNAJA3-002 - ENSP00000347445 [100%]
DNAJA3-201 - ENSP00000393970 [94%]
 DNAJA3-001 - ENSP00000262375 [100%]
DNAJA3-002 - ENSP00000347445 [100%]
DNAJA3-201 - ENSP00000393970 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human cerebral cortex shows strong, granular cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human duodenum shows distinct cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:150 1:75 1:40 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

52.5, 49.6, 33.1 52.5, 49.6, 33.1 52.5, 49.6, 33.1, 20.4, 13.1, 10.4, 8.0 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line MCF7 shows positivity in mitochondria.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 Application not done for this antibody. 

Antibody dilution

1:48 1:46  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
DNAJA3-001
 
DNAJA3-002
 
DNAJA3-201