TMC5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040810

 

Antibody HPA042037

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA040810 HPA042037 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

80 97 

Antigen sequence

TEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERRE
VEQQGFLHLGEHDGSLDLRSRRSVQEGNPR
 
STWREPDYSDAENGHDYGSSETPKMTRGVLSRTSSIQPSFRHRSDDPVGS
LWGENDYPEGIEMASMEMANSYGHSLPGAPGSGYVNPAYVGESGPVH
 

Matching transcripts

TMC5-001 - ENSP00000370822 [100%]
TMC5-002 - ENSP00000219821 [100%]
TMC5-004 - ENSP00000456148 [100%]
TMC5-005 - ENSP00000454710 [100%]
TMC5-006 - ENSP00000446274 [100%]
TMC5-007 - ENSP00000441227 [100%]
TMC5-201 - ENSP00000379531 [100%]
 TMC5-001 - ENSP00000370822 [100%]
TMC5-006 - ENSP00000446274 [100%]
TMC5-007 - ENSP00000441227 [100%]
TMC5-201 - ENSP00000379531 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows moderate cytoplasmic, membranous and nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:70 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

114.8, 108.9, 108.1, 87.8, 80.1, 75.5 114.8, 108.9, 108.1 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
TMC5-001
 
TMC5-002
 
TMC5-004
 
TMC5-005
 
TMC5-006
 
TMC5-007
 
TMC5-201