LACTB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036361

 

Antibody HPA036362

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA036361 HPA036362 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

89 80 

Antigen sequence

NSNENLLPGYLKPETMVMMWTPVPNTEMSWDKEGKYAMAWGVVEKKQTYG
SCRKQRHYASHTGGAVGASSVLLVLPEELDTETINNKVP
 
KEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFENS
IESLRLFKNDPLFFKPGSQFLYSTFGYTLL
 

Matching transcripts

LACTB-001 - ENSP00000261893 [99%]
 LACTB-001 - ENSP00000261893 [100%]
LACTB-002 - ENSP00000392956 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
More information
 Immunohistochemical staining of human ovary shows strong granular cytoplasmic positivity in follicle cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:500 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

60.7 60.7, 41.2 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 

Antibody dilution

 1:82 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
LACTB-001
 
LACTB-002