CSK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA026488

 

Antibody HPA028425

 

Antibody CAB011203

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA026488 HPA028425 C7863 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

5 6 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

66 80  

Antigen sequence

QDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGT
KLSLMPWFHGKITREQ
 
WSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVM
KNCWHLDAAMRPSFLQLREQLEHIKTHELH
 
 

Matching transcripts

CSK-001 - ENSP00000220003 [100%]
CSK-002 - ENSP00000414764 [100%]
CSK-006 - ENSP00000454906 [100%]
CSK-016 - ENSP00000457714 [100%]
CSK-201 - ENSP00000438808 [100%]
 CSK-001 - ENSP00000220003 [100%]
CSK-002 - ENSP00000414764 [100%]
CSK-006 - ENSP00000454906 [100%]
CSK-201 - ENSP00000438808 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human hippocampus shows distinct cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:300 1:1200 1:1500 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in golgi apparatus, vesicles & centrosome.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & vesicles.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & Golgi apparatus.
More information
 

Antibody dilution

1:50 1:100 1:200 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

50.7, 12.3 50.7 50.7, 12.3, 8.1, 7.1 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:6000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CSK-001
 
CSK-002
 
CSK-006
 
CSK-016
 
CSK-201