ACSBG1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041642

 

Antibody CAB045955

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Origene
 

Product name

HPA041642 TA501176 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

76  

Antigen sequence

ANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFME
LGNEVPEEALDAIIDTQQPNQCCVLV
 
 

Matching transcripts

ACSBG1-001 - ENSP00000258873 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in astrocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:300 1:800 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

81.3 81.3, 53.9, 27.6, 20.5, 15.7, 8.5, 6.1, 5.7 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
ACSBG1-001