TMEM87A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018104

 

Antibody HPA018189

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA018104 HPA018189 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

90 98 

Antigen sequence

RPSANNQRFAFSPLSEEEEEDEQKEPMLKESFEGMKMRSTKQEPNGNSKV
NKAQEDDLKWVEENVPSSVTDVALPALLDSDEERMITHFE
 
TTIFLKFDGEPCDLSLNITWYLKSADCYNEIYNFKAEEVELYLEKLKEKR
GLSGKYQTSSKLFQNCSELFKTQTFSGDFMHRLPLLGEKQEAKENGTN
 

Matching transcripts

TMEM87A-001 - ENSP00000374484 [100%]
TMEM87A-201 - ENSP00000405379 [100%]
 TMEM87A-001 - ENSP00000374484 [100%]
TMEM87A-002 - ENSP00000305894 [100%]
TMEM87A-201 - ENSP00000405379 [93%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human prostate shows strong cytoplasmic positivity with a granular pattern in glandular cells.
More information
 Immunohistochemical staining of human prostate shows strong cytoplasmic positivity with a granular pattern in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:160 1:25 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in golgi.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & golgi apparatus.
More information
 

Antibody dilution

1:62 1:2 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

63.4, 56.8 63.4, 56.8, 20.5 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
TMEM87A-001
 
TMEM87A-002
 
TMEM87A-201