SGK3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027146

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA027146 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

123 

Antigen sequence

DVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQ
NHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCV
SSDYSIVNASVLEADDAFVGFSY
 

Matching transcripts

SGK3-003 - ENSP00000430256 [100%]
SGK3-004 - ENSP00000430691 [100%]
SGK3-005 - ENSP00000430463 [100%]
SGK3-013 - ENSP00000331816 [100%]
SGK3-201 - ENSP00000379842 [100%]
 

Other gene match

C8orf44-SGK3 - ENSG00000270024 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human gall bladder shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:10 

Validation IH

Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415716)
More information
 

Target mass (kDa)

57.1, 53.3 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
SGK3-003
 
SGK3-004
 
SGK3-005
 
SGK3-013
 
SGK3-201