RIPK2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015273

 

Antibody HPA016499

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA015273 HPA016499 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

142 125 

Antigen sequence

LPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTP
CSSAIINPLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDAL
LSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVI
 
ITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMIS
LIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLKKTKLQSV
SSAIHLCDKKKMELSLNIPVNHGPQ
 

Matching transcripts

RIPK2-001 - ENSP00000220751 [100%]
RIPK2-201 - ENSP00000441623 [100%]
 RIPK2-001 - ENSP00000220751 [100%]
RIPK2-201 - ENSP00000441623 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in Umbrella cells.
More information
 Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in Trophoblasts.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10 1:400 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 

Antibody dilution

1:42 1:54 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418408)
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

61.2, 45.6 61.2, 45.6 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
RIPK2-001
 
RIPK2-201