DECR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA023160

 

Antibody HPA023162

 

Antibody HPA023238

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA023160 HPA023162 HPA023238 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

80 76 71 

Antigen sequence

VTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSL
AAEWGKYGMRFNVIQPGPIKTKGAFSRLDP
 
TFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVL
ISGEFNDLRKVTKEQWDTIEELIRKT
 
MDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVI
NNAAGNFISPTERLSPNAWKT
 

Matching transcripts

DECR1-001 - ENSP00000220764 [100%]
DECR1-003 - ENSP00000429779 [100%]
 DECR1-001 - ENSP00000220764 [100%]
DECR1-003 - ENSP00000429779 [100%]
 DECR1-001 - ENSP00000220764 [100%]
DECR1-003 - ENSP00000429779 [100%]
DECR1-008 - ENSP00000430561 [100%]
DECR1-013 - ENSP00000427936 [100%]
DECR1-014 - ENSP00000429096 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity with a granular pattern in tubular cells.
More information
 Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:10 1:1200 1:800 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

36.1, 35.0 36.1, 35.0 36.1, 35.0, 21.8, 19.3, 15.9 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:6000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & mitochondria.
More information
  

Antibody dilution

 1:50  

Validation IF

 Supportive: The subcellular location is supported by literature.  
 

ANTIGEN VIEW

? »
 
 
 
DECR1-001
 
DECR1-003
 
DECR1-008
 
DECR1-013
 
DECR1-014