SPAG1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA023748

 

Antibody HPA053682

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA023748 HPA053682 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

97 82 

Antigen sequence

PSIIEAKMELEEVTRLLNLKDKTAPFNKEKERRKIEIQEVNEGKEEPGRP
AGEVSTGCLASEKGGKSSRSPEDPEKLPIAKPNNAYEFGQIINALST
 
KKTPRDYAEWDKFDVEKECLKIDEDYKEKTVIDKSHLSKIETRIDTAGLT
EKEKDFLATREKEKGNEAFNSGDYEEAVMYYT
 

Matching transcripts

SPAG1-001 - ENSP00000373450 [99%]
SPAG1-201 - ENSP00000251809 [99%]
 SPAG1-001 - ENSP00000373450 [100%]
SPAG1-002 - ENSP00000427716 [100%]
SPAG1-004 - ENSP00000428070 [100%]
SPAG1-201 - ENSP00000251809 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows distinct cytoplasmic positivity in subsets of cells in ductus seminiferus.
More information
 Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:1000 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & microtubules.
More information
 Application not done for this antibody. 

Antibody dilution

1:50  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

  

Target mass (kDa)

103.6 103.6, 48.0 

Antibody dilution

1:250 1:1080 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:8650 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SPAG1-001
 
SPAG1-002
 
SPAG1-004
 
SPAG1-201