BNIP3L

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015652

 

Antibody CAB025371

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D systems
 

Product name

HPA015652 AF4030 

Host species

Rabbit Goat 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

4 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

133  

Antigen sequence

SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHC
DSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSD
WSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK
 
 

Matching transcripts

BNIP3L-001 - ENSP00000370003 [100%]
BNIP3L-002 - ENSP00000429698 [100%]
BNIP3L-004 - ENSP00000429851 [100%]
BNIP3L-006 - ENSP00000428597 [100%]
BNIP3L-007 - ENSP00000429171 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human epididymis shows strong cytoplasmic positivity.
More information
 Immunohistochemical staining of human corpus, uterine shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:400 1:250 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & mitochondria.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 

Antibody dilution

1:67 1:62 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

23.9, 20.1, 19.6 23.9, 20.1, 19.6, 6.8 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:6000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
BNIP3L-001
 
BNIP3L-002
 
BNIP3L-004
 
BNIP3L-006
 
BNIP3L-007