SARS2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA052730

 

Antibody HPA056957

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA052730 HPA056957 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

80 74 

Antigen sequence

QIYNIDPARFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRA
ETNTGQEPRGLYRVHHFTKVEMFGVTGPGL
 
RSLEEEKAAVTEAVRALLANQDSGEVQQDPKYQGLRARGREIRKELVHLY
PREAQLEEQFYLQALKLPNQTHPD
 

Matching transcripts

SARS2-001 - ENSP00000221431 [100%]
SARS2-003 - ENSP00000472847 [100%]
SARS2-006 - ENSP00000472339 [100%]
SARS2-201 - ENSP00000399330 [100%]
SARS2-005 - ENSP00000406754 [98%]
 SARS2-001 - ENSP00000221431 [100%]
SARS2-004 - ENSP00000414954 [100%]
SARS2-005 - ENSP00000406754 [100%]
SARS2-201 - ENSP00000399330 [100%]
 

Other gene match

CTC-360G5.8 - ENSG00000269547 [100%]
 CTC-360G5.8 - ENSG00000269547 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in granular pattern in tubular cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:50 1:500 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

65.6, 58.5, 58.3, 58.2, 58.0, 36.4 65.6, 58.5, 58.3, 58.2, 26.3 

Antibody dilution

1:110 1:570 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:850 1:6850 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SARS2-001
 
SARS2-003
 
SARS2-004
 
SARS2-005
 
SARS2-006
 
SARS2-201