VRK3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA016040

 

Antibody HPA056489

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA016040 HPA056489 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

116 73 

Antigen sequence

TTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGP
QKQKFSLKLDAKDGRLFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCM
GFGVHQDKYRFLVLPS
 
CPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSST
VTSPRLSLFSDGDSSESEDTLSS
 

Matching transcripts

VRK3-001 - ENSP00000324636 [100%]
VRK3-002 - ENSP00000366210 [100%]
VRK3-004 - ENSP00000472541 [100%]
VRK3-005 - ENSP00000471061 [100%]
VRK3-006 - ENSP00000470156 [100%]
VRK3-007 - ENSP00000473171 [100%]
VRK3-008 - ENSP00000469710 [100%]
VRK3-009 - ENSP00000469880 [100%]
 VRK3-001 - ENSP00000324636 [100%]
VRK3-004 - ENSP00000472541 [100%]
VRK3-007 - ENSP00000473171 [100%]
VRK3-008 - ENSP00000469710 [100%]
VRK3-009 - ENSP00000469880 [100%]
VRK3-014 - ENSP00000470359 [100%]
VRK3-017 - ENSP00000470940 [100%]
VRK3-022 - ENSP00000469092 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:150  

Literature conformity

No avaliable gene/protein characterization data  

RNA consistency

Mainly consistent with RNA expression data  

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A549 shows positivity in nucleus, nucleoli & vesicles.
More information
 

Antibody dilution

 1:116 

Validation IF

 Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

52.9, 47.5, 45.9, 45.2, 40.5 52.9, 45.9, 45.2, 19.9, 18.3, 12.0 

Antibody dilution

1:250 1:390 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:4650 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
VRK3-001
 
VRK3-002
 
VRK3-004
 
VRK3-005
 
VRK3-006
 
VRK3-007
 
VRK3-008
 
VRK3-009
 
VRK3-014
 
VRK3-017
 
VRK3-022
 
 »