CASP14

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027062

 

Antibody CAB010059

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA027062 sc-48336 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

133  

Antigen sequence

RLALILCVTKAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQFQEELEK
FQQAIDSREDPVSCAFVVLMAHGREGFLKGEDGEMVKLENLFEALNNKNC
QALRAKPKVYIIQACRGEQRDPGETVGGDEIVM
 
 

Matching transcripts

CASP14-001 - ENSP00000393417 [100%]
CASP14-201 - ENSP00000221740 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human skin shows strong cytoplasmic and nuclear positivity in keratinocytes.
More information
 Immunohistochemical staining of human skin shows strong nuclear positivity in epidermal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:2200 1:5000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

27.7 27.7 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CASP14-001
 
CASP14-201