MRPL4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051261

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051261 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

100 

Antigen sequence

MLQFVRAGARAWLRPTGSQGLSSLAEEAARATENPEQVASEGLPEPVLRK
VELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRLDILHQVA
 

Matching transcripts

MRPL4-001 - ENSP00000253099 [100%]
MRPL4-002 - ENSP00000465143 [100%]
MRPL4-003 - ENSP00000377334 [100%]
MRPL4-006 - ENSP00000468569 [100%]
MRPL4-007 - ENSP00000465635 [100%]
MRPL4-201 - ENSP00000306902 [100%]
MRPL4-009 - ENSP00000466050 [90%]
MRPL4-010 - ENSP00000466169 [82%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:500 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line MCF-7 shows positivity in nucleus, nucleoli & cytoplasm.
More information
 

Antibody dilution

1:85 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

39.6, 34.9, 33.8, 29.5, 24.4, 18.0, 14.1 

Antibody dilution

1:420 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3400 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
MRPL4-001
 
MRPL4-002
 
MRPL4-003
 
MRPL4-006
 
MRPL4-007
 
MRPL4-009
 
MRPL4-010
 
MRPL4-201