CEACAM5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011041

 

Antibody HPA019758

 

Antibody CAB000021

 

Antibody CAB000022

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 DakoCytomation
 

Product name

HPA011041 HPA019758 M7072 A0115 

Host species

Rabbit Rabbit Mouse Rabbit 

Clonality

pAb pAb mAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Supernatant Protein A/G 

Released in version

3 5 1 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Native protein Native protein 

Length (aa)

33 70   

Antigen sequence

NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE
 
QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNN
SKPVEDKDAVAFTCEPEAQN
 
 
 

Matching transcripts

CEACAM5-001 - ENSP00000221992 [82%]
CEACAM5-002 - ENSP00000381600 [82%]
CEACAM5-003 - ENSP00000385072 [82%]
CEACAM5-006 - ENSP00000473252 [82%]
CEACAM5-007 - ENSP00000468997 [82%]
 CEACAM5-001 - ENSP00000221992 [100%]
CEACAM5-002 - ENSP00000381600 [100%]
CEACAM5-003 - ENSP00000385072 [100%]
   

Other gene match

CEACAM1 - ENSG00000079385 [94%]
CEACAM6 - ENSG00000086548 [94%]
CEACAM3 - ENSG00000170956 [100%]
CEA - ENSG00000267881 [82%]
    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in a subset of leukocytes.
More information
 Immunohistochemical staining of human appendix shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells. Microvilli also displayed strong immunoreactivity.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH9 HIER pH9 

Antibody dilution

1:100 1:20 1:400 1:5000 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data for all of the genes Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419723)
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

76.8, 76.7, 57.6, 50.5, 50.3, 46.9, 43.1, 39.9, 38.6, 37.2, 27.5, 27.1, 22.8, 21.7, 19.4, 17.1, 15.6, 11.0, 10.9 76.8, 76.7 76.8, 76.7, 21.7, 15.6 76.8, 76.7, 21.7, 15.6 

Antibody dilution

1:250 1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:500 1:500   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
CEACAM5-001
 
CEACAM5-002
 
CEACAM5-003
 
CEACAM5-006
 
CEACAM5-007