LIG1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041431

 

Antibody HPA048071

 

Antibody CAB037015

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 ARETA international
 

Product name

HPA041431 HPA048071 K0190-3 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 13 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

101 87  

Antigen sequence

PSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKG
ISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGEDSGSDPED
T
 
RNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVL
TTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPL
 
 

Matching transcripts

LIG1-001 - ENSP00000263274 [100%]
LIG1-002 - ENSP00000442841 [100%]
LIG1-201 - ENSP00000441531 [100%]
 LIG1-001 - ENSP00000263274 [100%]
LIG1-002 - ENSP00000442841 [100%]
LIG1-004 - ENSP00000471380 [100%]
LIG1-006 - ENSP00000471836 [100%]
LIG1-201 - ENSP00000441531 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human duodenum shows distinct nuclear positivity in glandular cells.
More information
 Application not done for this antibody. Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:65  1:1500 

Literature conformity

Partly consistent with extensive gene/protein characterization data  Consistent with extensive gene/protein characterization data 

RNA consistency

Not done  Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in the Golgi apparatus & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & nucleoli.
More information
 

Antibody dilution

1:57 1:69 1:200 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

   

Target mass (kDa)

101.7, 98.2, 93.9 101.7, 98.2, 93.9, 88.5, 88.4 101.7, 98.2, 93.9, 88.5, 88.4, 45.0, 16.3, 15.8, 4.0, 3.2 

Antibody dilution

1:250 1:350 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:12000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
LIG1-001
 
LIG1-002
 
LIG1-004
 
LIG1-006
 
LIG1-201