CRHR2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046683

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA046683 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

52 

Antigen sequence

PCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLH
YR
 

Matching transcripts

CRHR2-001 - ENSP00000340943 [100%]
CRHR2-002 - ENSP00000418722 [100%]
CRHR2-201 - ENSP00000344304 [100%]
CRHR2-202 - ENSP00000426498 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:400 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

50.8, 47.7, 46.5, 42.8 

Antibody dilution

1:290 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2300 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
CRHR2-001
 
CRHR2-002
 
CRHR2-201
 
CRHR2-202