EPHB6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035784

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA035784 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

95 

Antigen sequence

LDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQ
DNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLY
 

Matching transcripts

EPHB6-001 - ENSP00000481994 [100%]
EPHB6-202 - ENSP00000404786 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:38 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

110.8 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
EPHB6-001
 
EPHB6-202