FAM188B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019475

 

Antibody HPA030129

 

Antibody HPA030130

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA019475 HPA030129 HPA030130 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

95 131 93 

Antigen sequence

TTLVNIYDLSDEDAGWRTSLSETSKARHDNLDGDVLGNFVSSKRPPHKSK
PMQTVPGETPVLTSAWEKIDKLHSEPSLDVKRMGENSRPKSGLIV
 
VQGCVLQKLLFEGDSKADCAQGLQPSDAHRTRCLVLALADIVWRAGGRER
AVVALASRTQQFSPTGKYKADGVLETLTLHSLTCYEDLVTFLQQSIHQFE
VGPYGCILLTLSAILSRSTELIRQDFDVPTS
 
LKTPRFPIWVVCSESHFSILFSLQPGLLRDWRTERLFDLYYYDGLANQQE
QIRLTIDTTQTISEDTDNDLVPPLELCIRTKWKGASVNWNGSD
 

Matching transcripts

FAM188B-001 - ENSP00000265299 [100%]
 FAM188B-001 - ENSP00000265299 [100%]
 FAM188B-001 - ENSP00000265299 [100%]
 

Other gene match

  AQP1 - ENSG00000240583 [86%]
AQP1 - ENSG00000250424 [86%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong membranous and cytoplasmic positivity in subsets of tubules.
More information
 Immunohistochemical staining of human kidney shows strong luminal membrane and additional cytoplasmic positivity in renal tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:50 1:100 1:25 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

84.4 84.4 84.4, 48.5, 35.6 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
FAM188B-001