MYL7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA013331

 

Antibody HPA039262

 

Antibody CAB033884

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA013331 HPA039262 sc-66967 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 10 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

72 25  

Antigen sequence

DPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTP
MDLAGNIDYKSLCYIITHGDEK
 
MFEQTQIQEFKEAFTIMDQNRDGFI
 
 

Matching transcripts

MYL7-001 - ENSP00000223364 [100%]
MYL7-003 - ENSP00000403360 [100%]
MYL7-005 - ENSP00000389202 [100%]
 MYL7-001 - ENSP00000223364 [80%]
MYL7-003 - ENSP00000403360 [80%]
MYL7-006 - ENSP00000403988 [80%]
  

Other gene match

 MYL9 - ENSG00000101335 [80%]
MYL12A - ENSG00000101608 [80%]
MYL2 - ENSG00000111245 [100%]
MYL12B - ENSG00000118680 [80%]
MYLPF - ENSG00000180209 [84%]
MYL5 - ENSG00000215375 [92%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:90 1:150 1:80 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412006)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400153)
More information
  

Target mass (kDa)

21.7, 19.4, 16.7 22.0, 20.5, 19.8, 19.5, 19.4, 19.0, 18.8, 18.5, 16.7, 15.2, 14.1, 13.9, 13.2, 13.1, 12.0 21.7, 19.4, 18.5, 16.7, 15.0, 11.7, 4.1, 3.0 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:30000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
MYL7-001
 
MYL7-003
 
MYL7-005
 
MYL7-006