GCK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007034

 

Antibody HPA007093

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007034 HPA007093 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

118 113 

Antigen sequence

RLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGL
RPSTTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVG
VDGSVYKLHPSFKERFHA
 
DLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYIS
ECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAE
GNNVVGLLRDAIK
 

Matching transcripts

GCK-001 - ENSP00000384247 [100%]
GCK-002 - ENSP00000223366 [100%]
GCK-003 - ENSP00000379142 [100%]
GCK-004 - ENSP00000402840 [100%]
GCK-201 - ENSP00000482149 [100%]
 GCK-001 - ENSP00000384247 [100%]
GCK-002 - ENSP00000223366 [100%]
GCK-003 - ENSP00000379142 [100%]
GCK-201 - ENSP00000482149 [100%]
GCK-004 - ENSP00000402840 [85%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in islet cells.
More information
 Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:35 1:25 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in the Golgi apparatus.
More information
 

Antibody dilution

1:65 1:40 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

52.2, 52.1, 52.0, 50.1 52.2, 52.1, 52.0, 50.1 

Antibody dilution

1:250 1:250 

Validation WB

Current setup is not applicable due to low RNA count Current setup is not applicable due to low RNA count 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
GCK-001
 
GCK-002
 
GCK-003
 
GCK-004
 
GCK-201