SPIN1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000162

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000162 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

107 

Antigen sequence

AVEHMFEGEHGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDY
KEGDLRIMPESSESPPTEREPGGVVDGLIGKHVEYTKEDGSKRIGMVIHQ
VEAKPSV
 

Matching transcripts

SPIN1-001 - ENSP00000365019 [85%]
SPIN1-201 - ENSP00000441864 [85%]
 

Other gene match

SPIN2A - ENSG00000147059 [99%]
SPIN2B - ENSG00000186787 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.
More information
 

Retrieval method

None 

Antibody dilution

1:50 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data for all of the genes 

         Western Blot

Image

 

Description

 

Target mass (kDa)

29.6, 29.2, 27.8 

Antibody dilution

1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SPIN1-001
 
SPIN1-201