SUPT6H

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036382

 

Antibody CAB012416

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA036382 32820 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

98  

Antigen sequence

RTTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTW
KVSDGIYQHVDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPM
 
 

Matching transcripts

SUPT6H-001 - ENSP00000319104 [100%]
SUPT6H-002 - ENSP00000338143 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human breast shows strong nuclear positivity in glandular cells and myoepithelial cells.
More information
 Immunohistochemical staining of human urinary bladder shows distinct nuclear positivity in urothelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:15 1:30 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:23 1:8 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Target too small/large to be analyzed with the present setup 

Target mass (kDa)

199.1 199.1, 5.9 

Antibody dilution

1:250  

Validation WB

Uncertain: No bands detected Target too small/large to be analyzed with the present setup 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
SUPT6H-001
 
SUPT6H-002