UBE2D3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003920

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003920 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

82 

Antigen sequence

LTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTD
YPFKPPKVAFTTKIYHPNINSNGSICLDILRS
 

Matching transcripts

UBE2D3-001 - ENSP00000396901 [95%]
UBE2D3-002 - ENSP00000345285 [95%]
UBE2D3-003 - ENSP00000349722 [95%]
UBE2D3-004 - ENSP00000378280 [95%]
UBE2D3-005 - ENSP00000378282 [95%]
UBE2D3-006 - ENSP00000337208 [95%]
UBE2D3-009 - ENSP00000423487 [95%]
UBE2D3-012 - ENSP00000344069 [95%]
UBE2D3-013 - ENSP00000318494 [95%]
UBE2D3-014 - ENSP00000337262 [95%]
UBE2D3-201 - ENSP00000378283 [95%]
 

Other gene match

UBE2D1 - ENSG00000072401 [93%]
UBE2D4 - ENSG00000078967 [100%]
UBE2D2 - ENSG00000131508 [95%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human breast shows cytoplasmic and nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:35 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data for all of the genes 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:10 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

16.9, 16.8, 16.7, 16.6, 15.9, 13.6, 10.7 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 « 
 
UBE2D3-001
 
UBE2D3-002
 
UBE2D3-003
 
UBE2D3-004
 
UBE2D3-005
 
UBE2D3-006
 
UBE2D3-009
 
UBE2D3-012
 
UBE2D3-013
 
UBE2D3-014
 
UBE2D3-201
 
 »