ELF2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA006057

 

Antibody HPA071166

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA006057 HPA071166 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

143 80 

Antigen sequence

MTSAVVDSGGTILELSSNGVENQEESEKVSEYPAVIVEPVPSARLEQGYA
AQVLVYDDETYMMQDVAEEQEVETENVETVEASVHSSNAHCTDKTIEAAE
ALLHMESPTCLRDSRSPEFIHAAMRPDVITETVVEVSTEESEP
 
TQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEEKPADGNK
TVTHVVVVSAPSAIALPVTMKTEGLVTCEK
 

Matching transcripts

ELF2-001 - ENSP00000377782 [100%]
ELF2-202 - ENSP00000368868 [92%]
 ELF2-001 - ENSP00000377782 [100%]
ELF2-002 - ENSP00000351458 [100%]
ELF2-006 - ENSP00000426997 [100%]
ELF2-201 - ENSP00000368867 [100%]
ELF2-202 - ENSP00000368868 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
More information
 Immunohistochemical staining of human duodenum shows nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:50 1:200 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Mainly consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:30  

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

64.0, 62.7 64.0, 62.7, 57.4, 56.1, 54.3 

Antibody dilution

1:250 1:160 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:1850 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ELF2-001
 
ELF2-002
 
ELF2-006
 
ELF2-201
 
ELF2-202