RPL34

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035139

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA035139 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

55 

Antigen sequence

MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCP
GRLRG
 

Matching transcripts

RPL34-001 - ENSP00000378162 [100%]
RPL34-002 - ENSP00000378160 [100%]
RPL34-003 - ENSP00000378163 [100%]
RPL34-005 - ENSP00000423316 [100%]
RPL34-006 - ENSP00000423983 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:10 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli & cytoplasm.
More information
 

Antibody dilution

1:40 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

13.3 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
RPL34-001
 
RPL34-002
 
RPL34-003
 
RPL34-005
 
RPL34-006