FBXW7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045958

 

Antibody CAB013793

 

Antibody CAB029987

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Zymed
 Santa Cruz Biotechnology
 

Product name

HPA045958 40-1500 sc-81829 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Affinity 

Released in version

13 4 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Recombinant protein 

Length (aa)

145   

Antigen sequence

LLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPK
DLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHS
PWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRI
 
 
 

Matching transcripts

FBXW7-001 - ENSP00000281708 [100%]
FBXW7-002 - ENSP00000474725 [100%]
FBXW7-003 - ENSP00000296555 [100%]
FBXW7-005 - ENSP00000263981 [100%]
FBXW7-007 - ENSP00000377528 [100%]
FBXW7-012 - ENSP00000474971 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Application not done for this antibody. Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:250 1:75 

Literature conformity

 Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

 Not done Mainly consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:81 1:62  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

   

Description

   

Target mass (kDa)

79.7, 70.3, 66.1, 59.7 79.7, 70.3, 66.1, 59.7, 20.0, 17.9 79.7, 70.3, 66.1, 59.7, 20.0, 17.9 

Antibody dilution

1:410 1:500 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3250   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
FBXW7-001
 
FBXW7-002
 
FBXW7-003
 
FBXW7-005
 
FBXW7-007
 
FBXW7-012