CRYAB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA028724

 

Antibody CAB002053

 

Antibody CAB040560

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 NCI-CPTC
 

Product name

HPA028724 NCL-ABCrys-512 CPTC-CRYAB-1 

Host species

Rabbit Mouse Mouse 

Clonality

pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G 

Released in version

6 1 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Recombinant protein 

Length (aa)

88   

Antigen sequence

RPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWF
DTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIE
 
 
 

Matching transcripts

CRYAB-001 - ENSP00000436051 [100%]
CRYAB-002 - ENSP00000433560 [100%]
CRYAB-003 - ENSP00000227251 [100%]
CRYAB-004 - ENSP00000434269 [100%]
CRYAB-005 - ENSP00000436089 [100%]
CRYAB-013 - ENSP00000437149 [100%]
CRYAB-014 - ENSP00000431754 [100%]
CRYAB-015 - ENSP00000434247 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human colon shows strong granular positivity in glandular cells.
More information
 Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:500 1:160 1:4000 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 

Antibody dilution

 1:40 1:50 

Validation IF

 Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419682)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

20.2, 20.0, 17.9, 15.4 20.2, 20.0, 17.9, 15.4, 12.3, 12.0, 11.7, 9.2, 8.2 20.2, 20.0, 17.9, 15.4, 12.3, 12.0, 11.7, 9.2, 8.2 

Antibody dilution

1:250 1:500 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:10000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
CRYAB-001
 
CRYAB-002
 
CRYAB-003
 
CRYAB-004
 
CRYAB-005
 
CRYAB-013
 
CRYAB-014
 
CRYAB-015