CCND1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027801

 

Antibody CAB000024

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA027801 NCL-L-CYCLIN D1-GM 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

63  

Antigen sequence

MPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNL
RSPNNFLSYYRLT
 
 

Matching transcripts

CCND1-001 - ENSP00000227507 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human esophagus shows strong nuclear positivity in a fraction of basal cells.
More information
 

Retrieval method

 HIER pH9 

Antibody dilution

 1:20 

Validation IH

 Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:20 1:5 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

33.7 33.7, 7.8 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CCND1-001