APOA4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001352

 

Antibody HPA002549

 

Antibody CAB068250

 

Antibody CAB068251

 

Antibody CAB068252

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
 Atlas Antibodies
 Atlas Antibodies
 

Product name

HPA001352 HPA002549 AMAb90767 AMAb90769 AMAb90768 

Host species

Rabbit Rabbit Mouse Mouse Mouse 

Clonality

pAb pAb mAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G Protein A/G 

Released in version

2 2 13 13 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein Recombinant protein Recombinant protein 

Length (aa)

134 148    

Antigen sequence

LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQK
SLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVE
GHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP
 
DKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARL
LPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQR
MERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVK
 
 
 
 

Matching transcripts

APOA4-001 - ENSP00000350425 [100%]
 APOA4-001 - ENSP00000350425 [99%]
    

Other gene match

     

ANTIBODY VALIDATION

         Immunohistochemistry

Image

     

Description

Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells, plasma was distinctly stained.
More information
 Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells, plasma was distinctly stained.
More information
 Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:2000 1:2000 1:4000 1:800 1:4000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data 

         Immunofluorescence

Image

     

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:61 1:200    

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available.    

         Western Blot

Image

     

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

45.4 45.4 45.4 45.4 45.4 

Antibody dilution

1:250 1:250 1:1000 1:1000 1:1000 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

     

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:3000    

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.    
 

ANTIGEN VIEW

? »
 
 
 
APOA4-001