SLC15A3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA047880

 

Antibody HPA057642

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA047880 HPA057642 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

56 39 

Antigen sequence

PMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQE
DIANFQ
 
QSTYVLQGLHLHIPNIFPANPANISVALRAQGSSYTIPE
 

Matching transcripts

SLC15A3-001 - ENSP00000227880 [100%]
SLC15A3-002 - ENSP00000445773 [100%]
SLC15A3-009 - ENSP00000439535 [100%]
 SLC15A3-001 - ENSP00000227880 [100%]
SLC15A3-009 - ENSP00000439535 [100%]
SLC15A3-002 - ENSP00000445773 [92%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human breast shows moderate cytoplasmic and membranous positivity in glandular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:25  

Literature conformity

No avaliable characterization data  

RNA consistency

Not done  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

63.6, 49.6, 23.5 63.6, 49.6, 23.5 

Antibody dilution

1:110 1:170 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:850 1:2100 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line SiHa shows positivity in vesicles.
More information
 

Antibody dilution

 1:52 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
SLC15A3-001
 
SLC15A3-002
 
SLC15A3-009