CARS

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002383

 

Antibody HPA002384

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA002383 HPA002384 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

136 129 

Antigen sequence

SQCNLYMAARKAVRKRPNQALLENIALYLTHMLKIFGAVEEDSSLGFPVG
GPGTSLSLEATVMPYLQVLSEFREGVRKIAREQKVPEILQLSDALRDNIL
PELGVRFEDHEGLPTVVKLVDRNTLLKEREEKRRVE
 
HLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAV
QLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDN
SIFSKLPKFWEGDFHRDMEALNVLPPDVL
 

Matching transcripts

CARS-001 - ENSP00000380300 [100%]
CARS-002 - ENSP00000278224 [100%]
CARS-004 - ENSP00000369897 [100%]
CARS-201 - ENSP00000380303 [100%]
CARS-202 - ENSP00000384069 [100%]
 CARS-001 - ENSP00000380300 [100%]
CARS-002 - ENSP00000278224 [100%]
CARS-004 - ENSP00000369897 [100%]
CARS-201 - ENSP00000380303 [100%]
CARS-202 - ENSP00000384069 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
More information
 Immunohistochemical staining of human pancreas shows cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:1000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 

Antibody dilution

1:65 1:105 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

94.6, 85.5, 84.5, 84.3, 82.8 94.6, 85.5, 84.5, 84.3, 82.8 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 1:2000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CARS-001
 
CARS-002
 
CARS-004
 
CARS-201
 
CARS-202