TENC1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA034659

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA034659 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

95 

Antigen sequence

VPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLPGPGQ
QPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSN
 

Matching transcripts

TENC1-001 - ENSP00000369232 [100%]
TENC1-002 - ENSP00000319756 [100%]
TENC1-003 - ENSP00000319684 [100%]
TENC1-008 - ENSP00000449363 [100%]
TENC1-010 - ENSP00000447021 [100%]
TENC1-017 - ENSP00000449361 [100%]
TENC1-201 - ENSP00000393362 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:250 

Literature conformity

Not consistent with gene/protein characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

 

Target mass (kDa)

153.6, 152.6, 152.5, 151.5, 146.0, 142.7, 138.8 

Antibody dilution

1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
TENC1-001
 
TENC1-002
 
TENC1-003
 
TENC1-008
 
TENC1-010
 
TENC1-017
 
TENC1-201