GTF2H3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004844

 

Antibody HPA053562

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA004844 HPA053562 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

128 24 

Antigen sequence

LNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKL
AVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSA
NEVIVEEIKDLMTKSDIKGQHTETLLAG
 
FSPICTTCETAFKISLPPVLKAKK
 

Matching transcripts

GTF2H3-001 - ENSP00000445162 [100%]
GTF2H3-011 - ENSP00000441894 [100%]
GTF2H3-004 - ENSP00000446429 [95%]
GTF2H3-003 - ENSP00000446097 [90%]
 GTF2H3-001 - ENSP00000445162 [100%]
GTF2H3-002 - ENSP00000228955 [100%]
GTF2H3-008 - ENSP00000438435 [100%]
GTF2H3-011 - ENSP00000441894 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic, membranous and nuclear positivity in cells in tubules.
More information
 Immunohistochemical staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:30 1:85 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

34.4, 28.9, 23.6, 19.8 34.4, 29.8, 28.9, 21.9 

Antibody dilution

1:250 1:200 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:1600 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
GTF2H3-001
 
GTF2H3-002
 
GTF2H3-003
 
GTF2H3-004
 
GTF2H3-008
 
GTF2H3-011