DDX55

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044101

 

Antibody HPA048180

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA044101 HPA048180 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

68 73 

Antigen sequence

KMNEKRKREEGSDIEDEDMEELLNDTRLLKKLKKGKITEEEFEKGLLTTG
KRTIKTVDLGISDLEDDC
 
FALLRMPKMPELRGKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRR
EKTENEGRRKFIKNKAWSKQKAK
 

Matching transcripts

DDX55-001 - ENSP00000238146 [100%]
DDX55-004 - ENSP00000443114 [100%]
DDX55-014 - ENSP00000442332 [100%]
 DDX55-001 - ENSP00000238146 [100%]
DDX55-004 - ENSP00000443114 [100%]
DDX55-014 - ENSP00000442332 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in subset of cells in seminiferus ducts.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:750  

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.
More information
 Immunofluorescent staining of human cell line HeLa shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:175 1:172 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

68.5, 65.2, 24.3 68.5, 65.2, 24.3 

Antibody dilution

1:250 1:870 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:6950 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
DDX55-001
 
DDX55-004
 
DDX55-014