GAPDH

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040067

 

Antibody CAB005197

 

Antibody CAB016392

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Santa Cruz Biotechnology
 

Product name

HPA040067 sc-20357 sc-47724 

Host species

Rabbit Goat Mouse 

Clonality

pAb msAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity Protein A/G 

Released in version

9 3 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Not known 

Length (aa)

64   

Antigen sequence

TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKA
GAHLQGGAKRVIIS
 
 
 

Matching transcripts

GAPDH-001 - ENSP00000229239 [100%]
GAPDH-002 - ENSP00000380070 [100%]
GAPDH-003 - ENSP00000380068 [100%]
GAPDH-008 - ENSP00000380067 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human stomach, lower shows strong nuclear and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows cytoplasmic and nuclear positivity in cells in tubules.
More information
 Immunohistochemical staining of human prostate shows moderate cytoplasmic and nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1000 1:50 1:45000 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

36.1, 31.5 36.1, 31.5, 27.9 36.1, 31.5, 27.9 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.
More information
   

Antibody dilution

1:43   

Validation IF

Supportive: The subcellular location is supported by literature.   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
GAPDH-001
 
GAPDH-002
 
GAPDH-003
 
GAPDH-008