SLCO1B3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004943

 

Antibody HPA050892

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA004943 HPA050892 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

50 26 

Antigen sequence

QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA
 
DVPLSYCNSECNCDESQWEPVCGNNG
 

Matching transcripts

SLCO1B3-001 - ENSP00000370956 [100%]
SLCO1B3-201 - ENSP00000261196 [100%]
 SLCO1B3-001 - ENSP00000370956 [100%]
SLCO1B3-005 - ENSP00000443225 [100%]
SLCO1B3-201 - ENSP00000261196 [100%]
SLCO1B3-202 - ENSP00000451758 [100%]
 

Other gene match

 SLCO1B1 - ENSG00000134538 [96%]
SLCO1B7 - ENSG00000205754 [100%]
LST3 - ENSG00000257046 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human liver shows strong membranous positivity in hepatocytes.
More information
 Immunohistochemical staining of human liver shows moderate membranous positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:200 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane.
More information
  

Antibody dilution

1:105  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

77.4 82.5, 77.4, 76.4, 76.3, 71.2, 52.8 

Antibody dilution

1:250 1:210 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:1700 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
SLCO1B3-001
 
SLCO1B3-005
 
SLCO1B3-201
 
SLCO1B3-202