ALDH5A1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029715

 

Antibody HPA029716

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029715 HPA029716 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

86 100 

Antigen sequence

RKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRV
YGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM
 
ANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQF
LVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQV
 

Matching transcripts

ALDH5A1-001 - ENSP00000350191 [100%]
ALDH5A1-002 - ENSP00000314649 [100%]
ALDH5A1-201 - ENSP00000438193 [100%]
 ALDH5A1-001 - ENSP00000350191 [100%]
ALDH5A1-002 - ENSP00000314649 [100%]
ALDH5A1-003 - ENSP00000417687 [100%]
ALDH5A1-201 - ENSP00000438193 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human liver shows distinct cytoplasmic positivity with a granular pattern in hepatocytes.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:300 1:400 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

58.7, 57.2, 48.3 58.7, 57.2, 53.9, 48.3 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line CACO-2 shows positivity in mitochondria.
More information
 

Antibody dilution

 1:50 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
ALDH5A1-001
 
ALDH5A1-002
 
ALDH5A1-003
 
ALDH5A1-201