TTK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA016834

 

Antibody CAB010166

 

Antibody CAB013229

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Zymed
 

Product name

HPA016834 sc-540 35-9100 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb msAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity Not known 

Released in version

4 3 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Not known 

Length (aa)

145   

Antigen sequence

EDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARI
QVRFAELKAIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKS
KQLLQKAVERGAVPLEMLEIALRNLNLQKKQLLSEEEKKNLSAST
 
 
 

Matching transcripts

TTK-001 - ENSP00000358813 [100%]
TTK-002 - ENSP00000230510 [100%]
TTK-003 - ENSP00000422936 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human small intestine shows strong positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
More information
 Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:150 1:250 1:35 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli & cytoplasm.
More information
  

Antibody dilution

 1:62  

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

97.1, 96.9 97.1, 96.9, 19.9, 17.1, 15.8, 9.3 97.1, 96.9, 19.9, 17.1, 15.8, 9.3 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   
 

ANTIGEN VIEW

? »
 
 
 
TTK-001
 
TTK-002
 
TTK-003