SKP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA053745

 

Antibody CAB012982

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Zymed
 

Product name

HPA053745 32-3800 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

84  

Antigen sequence

KRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKG
KTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
 
 

Matching transcripts

SKP1-001 - ENSP00000231487 [100%]
SKP1-004 - ENSP00000429961 [100%]
SKP1-005 - ENSP00000429686 [100%]
SKP1-002 - ENSP00000429472 [90%]
SKP1-008 - ENSP00000331708 [87%]
SKP1-009 - ENSP00000431067 [87%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human cerebellum shows strong nuclear and cytoplasmic positivity in cerebellar tissue.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:75 

Validation IH

 Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 213, 118, 83, 50, 33, 26, 18
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

18.7, 18.1, 17.9 18.7, 18.1, 17.9, 16.0, 11.6, 10.3, 4.6, 4.3, 2.0 

Antibody dilution

1:110 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line MCF-7 shows positivity in nucleus & cytoplasm.
More information
  

Antibody dilution

1:23  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:900  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SKP1-001
 
SKP1-002
 
SKP1-004
 
SKP1-005
 
SKP1-008
 
SKP1-009