FGF1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003265

 

Antibody CAB017519

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA003265 sc-55520 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

57  

Antigen sequence

GEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRS
DQHTDTK
 
 

Matching transcripts

FGF1-007 - ENSP00000354231 [100%]
FGF1-009 - ENSP00000383969 [95%]
FGF1-001 - ENSP00000352329 [93%]
FGF1-002 - ENSP00000338548 [93%]
FGF1-004 - ENSP00000378005 [93%]
FGF1-006 - ENSP00000404742 [93%]
FGF1-008 - ENSP00000367285 [93%]
FGF1-010 - ENSP00000396195 [93%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows distinct cytoplasmic positivity in tubular cells and glomeruli.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in subsets of glomerular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10 1:50 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nuclei but not nucleoli.
More information
  

Antibody dilution

1:10  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Target too small/large to be analyzed with the present setup Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

17.5, 10.4, 6.7, 6.5 17.5, 10.4, 6.7, 6.5, 4.6 

Antibody dilution

 1:500 

Validation WB

 Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
FGF1-001
 
FGF1-002
 
FGF1-004
 
FGF1-006
 
FGF1-007
 
FGF1-008
 
FGF1-009
 
FGF1-010