CSNK1A1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045614

 

Antibody CAB016680

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 AbFrontier
 

Product name

HPA045614 LF-PA0083 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

13 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

39  

Antigen sequence

IGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQLFLI
 
 

Matching transcripts

CSNK1A1-003 - ENSP00000421689 [100%]
CSNK1A1-004 - ENSP00000427031 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:15 1:150 

Literature conformity

Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Mainly not consistent with RNA expression data Mainly not consistent with RNA expression data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

41.9, 30.8 41.9, 38.9, 37.6, 30.8, 27.7, 20.0, 19.3, 15.6, 11.1, 9.8 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: No bands detected Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CSNK1A1-003
 
CSNK1A1-004