BCL6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004899

 

Antibody CAB000307

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 

Product name

HPA004899 M7211 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

3 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

129  

Antigen sequence

NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERP
SSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACIL
QASGSPPAKSPTDPKACNWKKYKFIVLNS
 
 

Matching transcripts

BCL6-001 - ENSP00000384371 [100%]
BCL6-004 - ENSP00000232014 [100%]
BCL6-010 - ENSP00000413122 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lymph node shows strong nuclear positivity in reaction center cells.
More information
 Immunohistochemical staining of human lymph node shows moderate nuclear positivity in reaction center cells.
More information
 

Retrieval method

HIER pH6 HIER pH9 

Antibody dilution

1:150 1:10 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

78.8, 72.4 78.8, 72.4, 13.9, 11.8, 6.2 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
  

Antibody dilution

1:95  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
BCL6-001
 
BCL6-004
 
BCL6-010