ABTB1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035022

 

Antibody HPA035023

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA035022 HPA035023 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

99 102 

Antigen sequence

GVEHVSDCERLAKQCQLWDLLSDLEAKCEKVSEFVASKPGTCVKVLTIEP
PPADPRLREDMALLADCALPPELRGDLWELPFPCPDGFNSCPDICFRVA
 
MLDEDTVVGVWRVAKLFRLARLEDQCTEYMAKVIEKLVEREDFVEAVKEE
AAAVAARQETDSIPLVDDIRFHVASTVQTYSAIEEAQQRLRALEDLLVSI
GL
 

Matching transcripts

ABTB1-001 - ENSP00000232744 [100%]
ABTB1-004 - ENSP00000412684 [100%]
ABTB1-006 - ENSP00000417366 [100%]
ABTB1-201 - ENSP00000377030 [100%]
 ABTB1-001 - ENSP00000232744 [100%]
ABTB1-004 - ENSP00000412684 [100%]
ABTB1-006 - ENSP00000417366 [100%]
ABTB1-201 - ENSP00000377030 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic and extracellular positivity in cells in tubules.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:600 1:700 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 

Antibody dilution

1:200 1:128 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

54.0, 37.6 54.0, 37.6 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ABTB1-001
 
ABTB1-004
 
ABTB1-006
 
ABTB1-201