ABCC5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA052295

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA052295 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

139 

Antigen sequence

SPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDA
SMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFS
WLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERL
 

Matching transcripts

ABCC5-001 - ENSP00000333926 [100%]
ABCC5-003 - ENSP00000416840 [100%]
ABCC5-004 - ENSP00000376358 [100%]
ABCC5-005 - ENSP00000371934 [100%]
ABCC5-006 - ENSP00000404809 [100%]
ABCC5-007 - ENSP00000403510 [100%]
ABCC5-201 - ENSP00000265586 [100%]
ABCC5-010 - ENSP00000399726 [96%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

160.7, 155.7, 53.0, 26.2, 25.3, 24.0, 23.7, 16.7 

Antibody dilution

1:180 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
ABCC5-001
 
ABCC5-003
 
ABCC5-004
 
ABCC5-005
 
ABCC5-006
 
ABCC5-007
 
ABCC5-010
 
ABCC5-201